SCOP 1.63: Domain d1ngyb2: 1ngy B:115-216

Lineage for d1ngyb2 (1ngy B:115-216)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Metal chelatase catalytic Fab 7G12, (human), kappa L chain [49089] (5 PDB entries)

8. Domain d1ngyb2: 1ngy B:115-216 [80499]
   Other proteins in same PDB: d1ngya1, d1ngyb1
   chimeric mature antibody

Details for d1ngyb2

PDB Entry: 1ngy, 2.2 Å

PDB Description: Chimeric Mature Fab 7g12-Apo

SCOP Domain Sequences for d1ngyb2:

Sequence; same for both SEQRES and ATOM records:

>d1ngyb2 b.1.1.2 (B:115-216) Immunoglobulin (constant domains of L and H chains) {Metal chelatase catalytic Fab 7G12, (human), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Timeline for d1ngyb2:

• d1ngyb2 is new in SCOP 1.63
  
• d1ngyb2 appears in SCOP 1.65
  
• d1ngyb2 appears in the current release, SCOPe 2.08