SCOP 1.63: Domain d1ngyb1: 1ngy B:1-114

Lineage for d1ngyb1 (1ngy B:1-114)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Metal chelatase catalytic Fab 7G12, (human), kappa L chain [48879] (5 PDB entries)

8. Domain d1ngyb1: 1ngy B:1-114 [80498]
   Other proteins in same PDB: d1ngya2, d1ngyb2
   chimeric mature antibody

Details for d1ngyb1

PDB Entry: 1ngy, 2.2 Å

PDB Description: Chimeric Mature Fab 7g12-Apo

SCOP Domain Sequences for d1ngyb1:

Sequence; same for both SEQRES and ATOM records:

>d1ngyb1 b.1.1.1 (B:1-114) Immunoglobulin (variable domains of L and H chains) {Metal chelatase catalytic Fab 7G12, (human), kappa L chain}
qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigmidpnsggtky
nekfkskatltvdkpsntaymqlssltsedsavyyctrrdmdywgagttvtvss

Timeline for d1ngyb1:

• d1ngyb1 is new in SCOP 1.63
  
• d1ngyb1 appears in SCOP 1.65
  
• d1ngyb1 appears in the current release, SCOPe 2.08