SCOPe 2.08: Domain d1ngyb1: 1ngy B:1-114

Lineage for d1ngyb1 (1ngy B:1-114)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (181 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1ngyb1: 1ngy B:1-114 [80498]
   Other proteins in same PDB: d1ngya1, d1ngya2, d1ngyb2
   part of metal chelatase catalytic Fab 7G12; chimeric mature antibody

Details for d1ngyb1

PDB Entry: 1ngy, 2.2 Å

PDB Description: Chimeric Mature Fab 7g12-Apo

PDB Compounds: (B:) Mature Metal Chelatase Catalytic Antibody, Heavy chain

SCOPe Domain Sequences for d1ngyb1:

Sequence; same for both SEQRES and ATOM records:

>d1ngyb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigmidpnsggtky
nekfkskatltvdkpsntaymqlssltsedsavyyctrrdmdywgagttvtvss

Timeline for d1ngyb1:

• d1ngyb1 first appeared in SCOP 1.63
  
• d1ngyb1 appears in SCOPe 2.07