SCOP 1.73: Domain d1ngwl1: 1ngw L:1-107

Lineage for d1ngwl1 (1ngw L:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d1ngwl1: 1ngw L:1-107 [80494]
   Other proteins in same PDB: d1ngwa2, d1ngwb1, d1ngwb2, d1ngwh1, d1ngwh2, d1ngwl2
   part of metal chelatase catalytic Fab 7G12; chimeric affinity matured antibody
   complexed with mmp

Details for d1ngwl1

PDB Entry: 1ngw, 2.6 Å

PDB Description: chimeric affinity matured fab 7g12 complexed with mesoporphyrin

PDB Compounds: (L:) Mature Metal Chelatase Catalytic Antibody, Light chain

SCOP Domain Sequences for d1ngwl1:

Sequence; same for both SEQRES and ATOM records:

>d1ngwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
elvmtqtpkfmsttvgdrvsitckasqnvgtpvawyqqkpgqspklliysasnrytgvpd
rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveik

Timeline for d1ngwl1:

• d1ngwl1 first appeared in SCOP 1.63
  
• d1ngwl1 appears in SCOP 1.71
  
• d1ngwl1 appears in SCOP 1.75
  
• d1ngwl1 appears in the current release, SCOPe 2.08