Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (62 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1ngwa2: 1ngw A:108-213 [80489] Other proteins in same PDB: d1ngwa1, d1ngwb1, d1ngwb2, d1ngwh1, d1ngwh2, d1ngwl1 |
PDB Entry: 1ngw (more details), 2.6 Å
SCOP Domain Sequences for d1ngwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngwa2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrne
Timeline for d1ngwa2: