| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (2 families) ![]() automatically mapped to Pfam PF01624 |
| Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein) |
| Protein DNA repair protein MutS, domain I [55273] (2 species) |
| Species Escherichia coli [TaxId:562] [55275] (8 PDB entries) Uniprot P23909 2-800 |
| Domain d1ng9b4: 1ng9 B:9-116 [80487] Other proteins in same PDB: d1ng9a1, d1ng9a2, d1ng9a3, d1ng9b1, d1ng9b2, d1ng9b3 complexed with adp, mg; mutant |
PDB Entry: 1ng9 (more details), 2.6 Å
SCOPe Domain Sequences for d1ng9b4:
Sequence, based on SEQRES records: (download)
>d1ng9b4 d.75.2.1 (B:9-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
ahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgasagepipm
agipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp
>d1ng9b4 d.75.2.1 (B:9-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
ahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltpipmagipyhav
enylaklvnqgesvaiceqverkvvrivtp
Timeline for d1ng9b4:
View in 3DDomains from other chains: (mouse over for more information) d1ng9a1, d1ng9a2, d1ng9a3, d1ng9a4 |