Lineage for d1ng9a3 (1ng9 A:117-269)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 702610Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family) (S)
  5. 702611Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein)
  6. 702612Protein DNA repair protein MutS, domain II [53152] (2 species)
  7. 702613Species Escherichia coli [TaxId:562] [53154] (10 PDB entries)
  8. 702623Domain d1ng9a3: 1ng9 A:117-269 [80482]
    Other proteins in same PDB: d1ng9a1, d1ng9a2, d1ng9a4, d1ng9b1, d1ng9b2, d1ng9b4

Details for d1ng9a3

PDB Entry: 1ng9 (more details), 2.6 Å

PDB Description: e.coli muts r697a: an atpase-asymmetry mutant
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1ng9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ng9a3 c.55.6.1 (A:117-269) DNA repair protein MutS, domain II {Escherichia coli [TaxId: 562]}
gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa
ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca
agcllqyakdtqrttlphirsitmereqdsiim

SCOP Domain Coordinates for d1ng9a3:

Click to download the PDB-style file with coordinates for d1ng9a3.
(The format of our PDB-style files is described here.)

Timeline for d1ng9a3: