Lineage for d1ng9a2 (1ng9 A:567-800)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 989641Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 989703Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)
  7. 989704Species Escherichia coli [TaxId:562] [52699] (10 PDB entries)
    Uniprot P23909 2-800
  8. 989716Domain d1ng9a2: 1ng9 A:567-800 [80481]
    Other proteins in same PDB: d1ng9a1, d1ng9a3, d1ng9a4, d1ng9b1, d1ng9b3, d1ng9b4
    complexed with adp, mg; mutant

Details for d1ng9a2

PDB Entry: 1ng9 (more details), 2.6 Å

PDB Description: e.coli muts r697a: an atpase-asymmetry mutant
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1ng9a2:

Sequence, based on SEQRES records: (download)

>d1ng9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate
yslvlmdeigagtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh
ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

Sequence, based on observed residues (ATOM records): (download)

>d1ng9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgagrstfmvemtetanilhnateyslvlm
deigagtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldaleh
gdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

SCOPe Domain Coordinates for d1ng9a2:

Click to download the PDB-style file with coordinates for d1ng9a2.
(The format of our PDB-style files is described here.)

Timeline for d1ng9a2: