Lineage for d1ng9a1 (1ng9 A:270-566)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646689Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 646690Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (1 family) (S)
  5. 646691Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein)
  6. 646692Protein DNA repair protein MutS, domain III [48336] (2 species)
  7. 646693Species Escherichia coli [TaxId:562] [48338] (10 PDB entries)
  8. 646703Domain d1ng9a1: 1ng9 A:270-566 [80480]
    Other proteins in same PDB: d1ng9a2, d1ng9a3, d1ng9a4, d1ng9b2, d1ng9b3, d1ng9b4

Details for d1ng9a1

PDB Entry: 1ng9 (more details), 2.6 Å

PDB Description: e.coli muts r697a: an atpase-asymmetry mutant
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1ng9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ng9a1 a.113.1.1 (A:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln

SCOP Domain Coordinates for d1ng9a1:

Click to download the PDB-style file with coordinates for d1ng9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ng9a1: