Class b: All beta proteins [48724] (126 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (7 families) |
Family b.121.4.7: Tombusviridae-like VP [88643] (4 proteins) |
Protein Sobemovirus coat protein [88644] (4 species) |
Species Cocksfoot mottle virus [TaxId:40979] [82010] (1 PDB entry) |
Domain d1ng0c_: 1ng0 C: [80477] complexed with ca |
PDB Entry: 1ng0 (more details), 2.7 Å
SCOP Domain Sequences for d1ng0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ng0c_ b.121.4.7 (C:) Sobemovirus coat protein {Cocksfoot mottle virus} vsrplnppaavgstlkagrgrtagvsdwfdtgmitsylggfqrtagttdsqvfivspaal drvgtiakayalwrpkhweivylprcstqtdgsiemgflldyadsvptntrtmasstsft tsnvwgggdgssllhtsmksmgnavtsalpcdefsnkwfklswstpeesenahltdtyvp arfvvrsdfpvvtadqpghlwlrsrillkgsvspstnl
Timeline for d1ng0c_: