Lineage for d1nexd2 (1nex D:370-744)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 379749Fold b.69: 7-bladed beta-propeller [50964] (12 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 379810Superfamily b.69.4: WD40-repeat [50978] (1 family) (S)
    also contains 8-bladed propellers
  5. 379811Family b.69.4.1: WD40-repeat [50979] (7 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 379842Protein Cdc4 propeller domain [82169] (1 species)
    8-bladed beta-propeller without perfect 8-fold symmetry
  7. 379843Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82170] (1 PDB entry)
  8. 379845Domain d1nexd2: 1nex D:370-744 [80448]
    Other proteins in same PDB: d1nexa1, d1nexa2, d1nexb1, d1nexc1, d1nexc2, d1nexd1
    complexed with mse, tpo; mutant

Details for d1nexd2

PDB Entry: 1nex (more details), 2.7 Å

PDB Description: crystal structure of scskp1-sccdc4-cpd peptide complex

SCOP Domain Sequences for d1nexd2:

Sequence, based on SEQRES records: (download)

>d1nexd2 b.69.4.1 (D:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae)}
fvpqrttlrghmtsvitclqfednyvitgaddkmirvydsinkkfllqlsghdggvwalk
yahggilvsgstdrtvrvwdikkgccthvfeghnstvrcldiveyknikyivtgsrdntl
hvwklpkessvpdhgeehdyplvfhtpeenpyfvgvlrghmasvrtvsghgnivvsgsyd
ntlivwdvaqmkclyilsghtdriystiydherkrcisasmdttiriwdlengelmytlq
ghtalvgllrlsdkflvsaaadgsirgwdandysrkfsyhhtnlsaittfyvsdnilvsg
senqfniynlrsgklvhanilkdadqiwsvnfkgktlvaavekdgqsfleildfs

Sequence, based on observed residues (ATOM records): (download)

>d1nexd2 b.69.4.1 (D:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae)}
fvpqrttlrghmtsvitclqfednyvitgaddkmirvydsinkkfllqlsghdggvwalk
yahggilvsgstdrtvrvwdikkgccthvfeghnstvrcldiveyknikyivtgsrdntl
hvwklpkdyplvfhtpeenpyfvgvlrghmasvrtvsghgnivvsgsydntlivwdvaqm
kclyilsghtdriystiydherkrcisasmdttiriwdlengelmytlqghtalvgllrl
sdkflvsaaadgsirgwdandysrkfsyhhtnlsaittfyvsdnilvsgsenqfniynlr
sgklvhanilkdadqiwsvnfkgktlvaavekdgqsfleildfs

SCOP Domain Coordinates for d1nexd2:

Click to download the PDB-style file with coordinates for d1nexd2.
(The format of our PDB-style files is described here.)

Timeline for d1nexd2: