Lineage for d1nexd1 (1nex D:270-369)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362107Fold a.158: F-box domain [81385] (1 superfamily)
    multihelical; interlocked heterodimer with the Skp1 dimerisation domain
  4. 362108Superfamily a.158.1: F-box domain [81383] (1 family) (S)
  5. 362109Family a.158.1.1: F-box domain [81381] (3 proteins)
  6. 362110Protein Cdc4 F-box and linker domains [81912] (1 species)
  7. 362111Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81913] (1 PDB entry)
  8. 362113Domain d1nexd1: 1nex D:270-369 [80447]
    Other proteins in same PDB: d1nexa1, d1nexa2, d1nexb2, d1nexc1, d1nexc2, d1nexd2
    complexed with mse, tpo; mutant

Details for d1nexd1

PDB Entry: 1nex (more details), 2.7 Å

PDB Description: crystal structure of scskp1-sccdc4-cpd peptide complex

SCOP Domain Sequences for d1nexd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nexd1 a.158.1.1 (D:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae)}
lkrdlitslpfeislkifnylqfediinslgvsqnwnkiirkstslwkkllisenfvspk
gfnslnlklsqkypklsqqdrlrlsflenifilknwynpk

SCOP Domain Coordinates for d1nexd1:

Click to download the PDB-style file with coordinates for d1nexd1.
(The format of our PDB-style files is described here.)

Timeline for d1nexd1: