Lineage for d1nexc2 (1nex C:4-103)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1202046Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1202047Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1202048Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)
  6. 1202072Protein Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D [82639] (1 species)
    Suppressor of kinetochore protein 1,Scskp1
  7. 1202073Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82640] (1 PDB entry)
  8. 1202075Domain d1nexc2: 1nex C:4-103 [80446]
    Other proteins in same PDB: d1nexa1, d1nexb1, d1nexb2, d1nexc1, d1nexd1, d1nexd2

Details for d1nexc2

PDB Entry: 1nex (more details), 2.7 Å

PDB Description: crystal structure of scskp1-sccdc4-cpd peptide complex
PDB Compounds: (C:) Centromere DNA-binding protein complex CBF3 subunit D

SCOPe Domain Sequences for d1nexc2:

Sequence, based on SEQRES records: (download)

>d1nexc2 d.42.1.1 (C:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
snvvlvsgegerftvdkkiaerslllknylndmgddddedddeivmpvpnvrssvlqkvi
ewaehhrdsnfp

Sequence, based on observed residues (ATOM records): (download)

>d1nexc2 d.42.1.1 (C:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
snvvlvsgegerftvdkkiaerslllknylivmpvpnvrssvlqkviewaehhrdsnfp

SCOPe Domain Coordinates for d1nexc2:

Click to download the PDB-style file with coordinates for d1nexc2.
(The format of our PDB-style files is described here.)

Timeline for d1nexc2: