SCOP 1.71: Domain d1nexc1: 1nex C:116-186

Lineage for d1nexc1 (1nex C:116-186)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family)

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins)

6. Protein Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D [81910] (1 species)
   Suppressor of kinetochore protein 1,Scskp1

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81911] (1 PDB entry)

8. Domain d1nexc1: 1nex C:116-186 [80445]
   Other proteins in same PDB: d1nexa2, d1nexb1, d1nexb2, d1nexc2, d1nexd1, d1nexd2
   complexed with mse, tpo; mutant

Details for d1nexc1

PDB Entry: 1nex, 2.7 Å

PDB Description: crystal structure of scskp1-sccdc4-cpd peptide complex

SCOP Domain Sequences for d1nexc1:

Sequence; same for both SEQRES and ATOM records:

>d1nexc1 a.157.1.1 (C:116-186) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae)}
vdswdreflkvdqemlyeiilaanylnikplldagckvvaemirgrspeeirrtfnivnd
ftpeeeaairr

Timeline for d1nexc1:

• d1nexc1 first appeared in SCOP 1.63
  
• d1nexc1 appears in SCOP 1.69
  
• d1nexc1 appears in SCOP 1.73
  
• d1nexc1 appears in the current release, SCOPe 2.08