SCOPe 2.01: Domain d1nexa1: 1nex A:116-185

Lineage for d1nexa1 (1nex A:116-185)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family)

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins)

6. Protein Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D [81910] (1 species)
   Suppressor of kinetochore protein 1,Scskp1

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81911] (1 PDB entry)

8. Domain d1nexa1: 1nex A:116-185 [80441]
   Other proteins in same PDB: d1nexa2, d1nexb1, d1nexb2, d1nexc2, d1nexd1, d1nexd2

Details for d1nexa1

PDB Entry: 1nex, 2.7 Å

PDB Description: crystal structure of scskp1-sccdc4-cpd peptide complex

PDB Compounds: (A:) Centromere DNA-binding protein complex CBF3 subunit D

SCOPe Domain Sequences for d1nexa1:

Sequence; same for both SEQRES and ATOM records:

>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vdswdreflkvdqemlyeiilaanylnikplldagckvvaemirgrspeeirrtfnivnd
ftpeeeaair

Timeline for d1nexa1:

• d1nexa1 first appeared in SCOP 1.63
  
• d1nexa1 appears in SCOP 1.75
  
• d1nexa1 appears in SCOPe 2.02
  
• d1nexa1 appears in the current release, SCOPe 2.08