SCOP 1.73: Domain d1nd6a_: 1nd6 A:

Lineage for d1nd6a_ (1nd6 A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families)

5. Family c.60.1.2: Histidine acid phosphatase [53258] (3 proteins)

6. Protein Prostatic acid phosphatase [53259] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53261] (4 PDB entries)

8. Domain d1nd6a_: 1nd6 A: [80407]

Details for d1nd6a_

PDB Entry: 1nd6, 2.4 Å

PDB Description: crystal structures of human prostatic acid phosphatase in complex with a phosphate ion and alpha-benzylaminobenzylphosphonic acid update the mechanistic picture and offer new insights into inhibitor design

PDB Compounds: (A:) prostatic acid phosphatase

SCOP Domain Sequences for d1nd6a_:

Sequence; same for both SEQRES and ATOM records:

>d1nd6a_ c.60.1.2 (A:) Prostatic acid phosphatase {Human (Homo sapiens) [TaxId: 9606]}
kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt

Timeline for d1nd6a_:

• d1nd6a_ first appeared in SCOP 1.63
  
• d1nd6a_ appears in SCOP 1.71
  
• d1nd6a_ appears in SCOP 1.75
  
• d1nd6a_ appears in the current release, SCOPe 2.08