Lineage for d1nd5b_ (1nd5 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588092Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 588093Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families) (S)
  5. 588145Family c.60.1.2: Histidine acid phosphatase [53258] (3 proteins)
  6. 588169Protein Prostatic acid phosphatase [53259] (2 species)
  7. 588170Species Human (Homo sapiens) [TaxId:9606] [53261] (4 PDB entries)
  8. 588176Domain d1nd5b_: 1nd5 B: [80404]

Details for d1nd5b_

PDB Entry: 1nd5 (more details), 2.9 Å

PDB Description: Crystal Structures of Human Prostatic Acid Phosphatase in Complex with a Phosphate Ion and alpha-Benzylaminobenzylphosphonic Acid Update the Mechanistic Picture and Offer New Insights into Inhibitor Design

SCOP Domain Sequences for d1nd5b_:

Sequence, based on SEQRES records: (download)

>d1nd5b_ c.60.1.2 (B:) Prostatic acid phosphatase {Human (Homo sapiens)}
kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
netqhepyplmlpgcspscplerfaelvgpvipqdwstecmtt

Sequence, based on observed residues (ATOM records): (download)

>d1nd5b_ c.60.1.2 (B:) Prostatic acid phosphatase {Human (Homo sapiens)}
kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
llylpfrncprqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydpl
ycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmkr
atqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyrn
etqhepyplmlpgcspscplerfaelvgpvipqdwstecmtt

SCOP Domain Coordinates for d1nd5b_:

Click to download the PDB-style file with coordinates for d1nd5b_.
(The format of our PDB-style files is described here.)

Timeline for d1nd5b_: