Lineage for d1nbwd_ (1nbw D:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245573Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 245660Superfamily c.51.3: B12-dependend dehydatases associated subunit [52968] (2 families) (S)
  5. 245675Family c.51.3.2: Glycerol dehydratase reactivase, beta subunit [82433] (1 protein)
  6. 245676Protein Glycerol dehydratase reactivase, beta subunit [82434] (1 species)
  7. 245677Species Klebsiella pneumoniae [TaxId:573] [82435] (1 PDB entry)
  8. 245679Domain d1nbwd_: 1nbw D: [80400]
    Other proteins in same PDB: d1nbwa1, d1nbwa2, d1nbwa3, d1nbwc1, d1nbwc2, d1nbwc3
    complexed with ca

Details for d1nbwd_

PDB Entry: 1nbw (more details), 2.4 Å

PDB Description: Glycerol dehydratase reactivase

SCOP Domain Sequences for d1nbwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbwd_ c.51.3.2 (D:) Glycerol dehydratase reactivase, beta subunit {Klebsiella pneumoniae}
ppgvrlfydprghhagainelcwgleeqgvpcqtitydgggdaaalgalaarssplrvgi
glsasgeialthaqlpadaplatghvtdsddqlrtlganagqlvkvlplsern

SCOP Domain Coordinates for d1nbwd_:

Click to download the PDB-style file with coordinates for d1nbwd_.
(The format of our PDB-style files is described here.)

Timeline for d1nbwd_: