Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.3: B12-dependend dehydatases associated subunit [52968] (2 families) |
Family c.51.3.2: Glycerol dehydratase reactivase, beta subunit [82433] (1 protein) |
Protein Glycerol dehydratase reactivase, beta subunit [82434] (1 species) |
Species Klebsiella pneumoniae [TaxId:573] [82435] (1 PDB entry) |
Domain d1nbwd_: 1nbw D: [80400] Other proteins in same PDB: d1nbwa1, d1nbwa2, d1nbwa3, d1nbwc1, d1nbwc2, d1nbwc3 complexed with ca |
PDB Entry: 1nbw (more details), 2.4 Å
SCOP Domain Sequences for d1nbwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nbwd_ c.51.3.2 (D:) Glycerol dehydratase reactivase, beta subunit {Klebsiella pneumoniae} ppgvrlfydprghhagainelcwgleeqgvpcqtitydgggdaaalgalaarssplrvgi glsasgeialthaqlpadaplatghvtdsddqlrtlganagqlvkvlplsern
Timeline for d1nbwd_: