Lineage for d1nbwc3 (1nbw C:406-606)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488063Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) (S)
    duplication contains two domains of this fold
  5. 488349Family c.55.1.6: ATPase domain of the glycerol dehydratase reactivase alpha subunit [82440] (1 protein)
  6. 488350Protein ATPase domain of the glycerol dehydratase reactivase alpha subunit [82441] (1 species)
    includes the insert and linker domains
  7. 488351Species Klebsiella pneumoniae [TaxId:573] [82442] (1 PDB entry)
  8. 488355Domain d1nbwc3: 1nbw C:406-606 [80399]
    Other proteins in same PDB: d1nbwa1, d1nbwb_, d1nbwc1, d1nbwd_

Details for d1nbwc3

PDB Entry: 1nbw (more details), 2.4 Å

PDB Description: Glycerol dehydratase reactivase

SCOP Domain Sequences for d1nbwc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbwc3 c.55.1.6 (C:406-606) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae}
gcaaplaildlgagstdaaivnaegqitavhlagagnmvslliktelgledlslaeaikk
yplakveslfsirhengaveffrealspavfakvvyikegelvpidnasplekirlvrrq
akekvfvtnclralrqvspggsirdiafvvlvggssldfeipqlitealshygvvagqgn
irgtegprnavatglllagqa

SCOP Domain Coordinates for d1nbwc3:

Click to download the PDB-style file with coordinates for d1nbwc3.
(The format of our PDB-style files is described here.)

Timeline for d1nbwc3: