Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) duplication contains two domains of this fold |
Family c.55.1.6: ATPase domain of the glycerol dehydratase reactivase alpha subunit [82440] (1 protein) |
Protein ATPase domain of the glycerol dehydratase reactivase alpha subunit [82441] (1 species) includes the insert and linker domains |
Species Klebsiella pneumoniae [TaxId:573] [82442] (1 PDB entry) |
Domain d1nbwc3: 1nbw C:406-606 [80399] Other proteins in same PDB: d1nbwa1, d1nbwb_, d1nbwc1, d1nbwd_ complexed with ca |
PDB Entry: 1nbw (more details), 2.4 Å
SCOP Domain Sequences for d1nbwc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nbwc3 c.55.1.6 (C:406-606) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae} gcaaplaildlgagstdaaivnaegqitavhlagagnmvslliktelgledlslaeaikk yplakveslfsirhengaveffrealspavfakvvyikegelvpidnasplekirlvrrq akekvfvtnclralrqvspggsirdiafvvlvggssldfeipqlitealshygvvagqgn irgtegprnavatglllagqa
Timeline for d1nbwc3: