Lineage for d1nbwc1 (1nbw C:92-256)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2851416Superfamily c.8.6: Swiveling domain of dehydratase reactivase alpha subunit [82317] (1 family) (S)
  5. 2851417Family c.8.6.1: Swiveling domain of dehydratase reactivase alpha subunit [82318] (2 proteins)
  6. 2851424Protein Swiveling domain of the glycerol dehydratase reactivase alpha subunit [82319] (1 species)
  7. 2851425Species Klebsiella pneumoniae [TaxId:573] [82320] (1 PDB entry)
  8. 2851427Domain d1nbwc1: 1nbw C:92-256 [80397]
    Other proteins in same PDB: d1nbwa2, d1nbwa3, d1nbwb_, d1nbwc2, d1nbwc3, d1nbwd_
    complexed with ca

Details for d1nbwc1

PDB Entry: 1nbw (more details), 2.4 Å

PDB Description: Glycerol dehydratase reactivase
PDB Compounds: (C:) glycerol dehydratase reactivase alpha subunit

SCOPe Domain Sequences for d1nbwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbwc1 c.8.6.1 (C:92-256) Swiveling domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]}
itestmighnpqtpggvgvgvgttialgrlatlpaaqyaegwivliddavdfldavwwln
ealdrginvvaailkkddgvlvnnrlrktlpvvdevtlleqvpegvmaavevaapgqvvr
ilsnpygiatffglspeetqaivpiaralignrsavvlktpqgdv

SCOPe Domain Coordinates for d1nbwc1:

Click to download the PDB-style file with coordinates for d1nbwc1.
(The format of our PDB-style files is described here.)

Timeline for d1nbwc1: