Lineage for d1nbwb_ (1nbw B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2135875Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2136054Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) (S)
  5. 2136079Family c.51.3.2: Dehydratase-reactivating factor beta subunit [82433] (3 proteins)
    automatically mapped to Pfam PF02288
  6. 2136083Protein Glycerol dehydratase reactivase, beta subunit [82434] (1 species)
  7. 2136084Species Klebsiella pneumoniae [TaxId:573] [82435] (1 PDB entry)
  8. 2136085Domain d1nbwb_: 1nbw B: [80396]
    Other proteins in same PDB: d1nbwa1, d1nbwa2, d1nbwa3, d1nbwc1, d1nbwc2, d1nbwc3
    complexed with ca

Details for d1nbwb_

PDB Entry: 1nbw (more details), 2.4 Å

PDB Description: Glycerol dehydratase reactivase
PDB Compounds: (B:) glycerol dehydratase reactivase beta subunit

SCOPe Domain Sequences for d1nbwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbwb_ c.51.3.2 (B:) Glycerol dehydratase reactivase, beta subunit {Klebsiella pneumoniae [TaxId: 573]}
ppgvrlfydprghhagainelcwgleeqgvpcqtitydgggdaaalgalaarssplrvgi
glsasgeialthaqlpadaplatghvtdsddqlrtlganagqlvkvlplsern

SCOPe Domain Coordinates for d1nbwb_:

Click to download the PDB-style file with coordinates for d1nbwb_.
(The format of our PDB-style files is described here.)

Timeline for d1nbwb_: