Lineage for d1nbwa3 (1nbw A:406-607)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884512Family c.55.1.6: ATPase domain of dehydratase reactivase alpha subunit [82440] (2 proteins)
  6. 2884513Protein ATPase domain of the glycerol dehydratase reactivase alpha subunit [82441] (1 species)
    includes the insert and linker domains
  7. 2884514Species Klebsiella pneumoniae [TaxId:573] [82442] (1 PDB entry)
  8. 2884516Domain d1nbwa3: 1nbw A:406-607 [80395]
    Other proteins in same PDB: d1nbwa1, d1nbwb_, d1nbwc1, d1nbwd_
    complexed with ca

Details for d1nbwa3

PDB Entry: 1nbw (more details), 2.4 Å

PDB Description: Glycerol dehydratase reactivase
PDB Compounds: (A:) glycerol dehydratase reactivase alpha subunit

SCOPe Domain Sequences for d1nbwa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbwa3 c.55.1.6 (A:406-607) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]}
gcaaplaildlgagstdaaivnaegqitavhlagagnmvslliktelgledlslaeaikk
yplakveslfsirhengaveffrealspavfakvvyikegelvpidnasplekirlvrrq
akekvfvtnclralrqvspggsirdiafvvlvggssldfeipqlitealshygvvagqgn
irgtegprnavatglllagqan

SCOPe Domain Coordinates for d1nbwa3:

Click to download the PDB-style file with coordinates for d1nbwa3.
(The format of our PDB-style files is described here.)

Timeline for d1nbwa3: