Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (6 families) |
Family d.15.1.1: Ubiquitin-related [54237] (26 proteins) Pfam 00240 |
Protein Ubiquitin [54238] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54239] (19 PDB entries) identical sequence in many other species |
Domain d1nbfd_: 1nbf D: [80390] Other proteins in same PDB: d1nbfa_, d1nbfb_, d1nbfe_ complex with USP7 complexed with glz |
PDB Entry: 1nbf (more details), 2.3 Å
SCOP Domain Sequences for d1nbfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nbfd_ d.15.1.1 (D:) Ubiquitin {Human (Homo sapiens)} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d1nbfd_:
View in 3D Domains from other chains: (mouse over for more information) d1nbfa_, d1nbfb_, d1nbfc_, d1nbfe_ |