Lineage for d1nbfb_ (1nbf B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 252917Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 252918Superfamily d.3.1: Cysteine proteinases [54001] (9 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 253171Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) [82568] (1 protein)
  6. 253172Protein Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) [82569] (1 species)
  7. 253173Species Human (Homo sapiens) [TaxId:9606] [82570] (2 PDB entries)
  8. 253175Domain d1nbfb_: 1nbf B: [80388]
    Other proteins in same PDB: d1nbfc_, d1nbfd_

Details for d1nbfb_

PDB Entry: 1nbf (more details), 2.3 Å

PDB Description: crystal structure of a ubp-family deubiquitinating enzyme in isolation and in complex with ubiquitin aldehyde

SCOP Domain Sequences for d1nbfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbfb_ d.3.1.9 (B:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens)}
kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel
qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk
mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq
eaekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpan
yilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsv
rhctnaymlvyiresklsevlqavtdhdipqqlverlqeekrieaqk

SCOP Domain Coordinates for d1nbfb_:

Click to download the PDB-style file with coordinates for d1nbfb_.
(The format of our PDB-style files is described here.)

Timeline for d1nbfb_: