Lineage for d1nb8a_ (1nb8 A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 851268Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 851269Superfamily d.3.1: Cysteine proteinases [54001] (22 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 851728Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (5 proteins)
    Pfam PF00443
  6. 851742Protein Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) [82569] (1 species)
  7. 851743Species Human (Homo sapiens) [TaxId:9606] [82570] (2 PDB entries)
  8. 851747Domain d1nb8a_: 1nb8 A: [80385]

Details for d1nb8a_

PDB Entry: 1nb8 (more details), 2.3 Å

PDB Description: structure of the catalytic domain of usp7 (hausp)
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 7

SCOP Domain Sequences for d1nb8a_:

Sequence, based on SEQRES records: (download)

>d1nb8a_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]}
kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel
qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk
mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq
eaekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpan
yilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsv
rhctnaymlvyiresklsevlqavtdhdipqqlverlqeekrieaqk

Sequence, based on observed residues (ATOM records): (download)

>d1nb8a_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]}
kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel
qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk
mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq
eaekgvkfltlppvlhlqlmrfmikindrfefpeqlpldeflqktdpkdpanyilhavlv
hsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghhctnaymlvyires
klsevlqavtdhdipqqlverlqeekrieaqk

SCOP Domain Coordinates for d1nb8a_:

Click to download the PDB-style file with coordinates for d1nb8a_.
(The format of our PDB-style files is described here.)

Timeline for d1nb8a_:

Domains from other chains:
(mouse over for more information)
d1nb8b_