Lineage for d1n9ca_ (1n9c A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304440Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (11 species)
  7. 2304451Species Bacillus pasteurii [TaxId:1474] [46629] (5 PDB entries)
  8. 2304456Domain d1n9ca_: 1n9c A: [80340]
    complexed with hec

Details for d1n9ca_

PDB Entry: 1n9c (more details)

PDB Description: structure and dynamics of reduced bacillus pasteurii cytochrome c: oxidation state dependent properties and implications for electron transfer processes
PDB Compounds: (A:) cytochrome c-553

SCOPe Domain Sequences for d1n9ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9ca_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Bacillus pasteurii [TaxId: 1474]}
vdaeavvqqkcischggdltgasapaidkaganyseeeildiilngqggmpggiakgaea
eavaawlaekk

SCOPe Domain Coordinates for d1n9ca_:

Click to download the PDB-style file with coordinates for d1n9ca_.
(The format of our PDB-style files is described here.)

Timeline for d1n9ca_: