Lineage for d1n91a1 (1n91 A:1-100)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006292Fold d.206: YggU-like [69785] (1 superfamily)
    beta(2)-loop-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243; some similarity to the Homing endonuclease-like fold
  4. 3006293Superfamily d.206.1: YggU-like [69786] (1 family) (S)
  5. 3006294Family d.206.1.1: YggU-like [69787] (2 proteins)
  6. 3006298Protein Hypothetical protein YggU [82745] (1 species)
  7. 3006299Species Escherichia coli, o157 [TaxId:562] [82746] (2 PDB entries)
  8. 3006300Domain d1n91a1: 1n91 A:1-100 [80326]
    Other proteins in same PDB: d1n91a2
    structural genomics
    CASP5

Details for d1n91a1

PDB Entry: 1n91 (more details)

PDB Description: solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14.
PDB Compounds: (A:) orf, hypothetical protein

SCOPe Domain Sequences for d1n91a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n91a1 d.206.1.1 (A:1-100) Hypothetical protein YggU {Escherichia coli, o157 [TaxId: 562]}
mdgvmsavtvnddglvlrlyiqpkasrdsivglhgdevkvaitappvdgqanshlvkflg
kqfrvaksqvviekgelgrhkqikiinpqqippevaalin

SCOPe Domain Coordinates for d1n91a1:

Click to download the PDB-style file with coordinates for d1n91a1.
(The format of our PDB-style files is described here.)

Timeline for d1n91a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n91a2