Lineage for d1n8zc4 (1n8z C:489-607)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030968Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 3030969Family g.3.9.1: Growth factor receptor domain [57185] (11 proteins)
    Pfam PF00757; Pfam PF14843; Pfam PF15913
    heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures
  6. 3031002Protein Protooncoprotein Her2 extracellular domain [82889] (2 species)
  7. 3031003Species Human (Homo sapiens) [TaxId:9606] [82890] (2 PDB entries)
  8. 3031005Domain d1n8zc4: 1n8z C:489-607 [80325]
    Other proteins in same PDB: d1n8za1, d1n8za2, d1n8zb1, d1n8zb2, d1n8zc1, d1n8zc2
    complexed with nag, so4

Details for d1n8zc4

PDB Entry: 1n8z (more details), 2.52 Å

PDB Description: crystal structure of extracellular domain of human her2 complexed with herceptin fab
PDB Compounds: (C:) Receptor protein-tyrosine kinase erbB-2

SCOPe Domain Sequences for d1n8zc4:

Sequence, based on SEQRES records: (download)

>d1n8zc4 g.3.9.1 (C:489-607) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
chqlcarghcwgpgptqcvncsqflrgqecveecrvlqglpreyvnarhclpchpecqpq
ngsvtcfgpeadqcvacahykdppfcvarcpsgvkpdlsympiwkfpdeegacqpcpin

Sequence, based on observed residues (ATOM records): (download)

>d1n8zc4 g.3.9.1 (C:489-607) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
chqlcarghcwgpgptqcvncsqflrgqecveecrvlqglpreyvnarhclpchpecqpq
ngsvtcfgpeadqcvacahykdppfcvarcpsiwkfpdeegacqpcpin

SCOPe Domain Coordinates for d1n8zc4:

Click to download the PDB-style file with coordinates for d1n8zc4.
(The format of our PDB-style files is described here.)

Timeline for d1n8zc4: