Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (8 families) less regular structure consisting of variable repeats |
Family c.10.2.5: L domain [52071] (4 proteins) this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain |
Protein Protooncoprotein Her2 extracellular domain [82328] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [82329] (2 PDB entries) |
Domain d1n8zc2: 1n8z C:323-488 [80323] Other proteins in same PDB: d1n8za1, d1n8za2, d1n8zb1, d1n8zb2, d1n8zc3, d1n8zc4 complexed with nag, so4 |
PDB Entry: 1n8z (more details), 2.52 Å
SCOP Domain Sequences for d1n8zc2:
Sequence, based on SEQRES records: (download)
>d1n8zc2 c.10.2.5 (C:323-488) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens)} lgmehlrevravtsaniqefagckkifgslaflpesfdgdpasntaplqpeqlqvfetle eitgylyisawpdslpdlsvfqnlqvirgrilhngaysltlqglgiswlglrslrelgsg lalihhnthlcfvhtvpwdqlfrnphqallhtanrpedecvgegla
>d1n8zc2 c.10.2.5 (C:323-488) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens)} lgmehlrevravtsaniqefagckkifgslaflpesfdsntaplqpeqlqvfetleeitg ylyisawpdslpdlsvfqnlqvirgrilhngaysltlqglgiswlglrslrelgsglali hhnthlcfvhtvpwdqlfrnphqallhtanrpedecvgegla
Timeline for d1n8zc2:
View in 3D Domains from other chains: (mouse over for more information) d1n8za1, d1n8za2, d1n8zb1, d1n8zb2 |