Lineage for d1n8zb2 (1n8z B:121-220)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1292198Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1292202Species Human (Homo sapiens) [TaxId:9606] [88575] (177 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 1292396Domain d1n8zb2: 1n8z B:121-220 [80321]
    Other proteins in same PDB: d1n8za1, d1n8za2, d1n8zb1, d1n8zc1, d1n8zc2, d1n8zc3, d1n8zc4
    part of humanized Fab 4D5, herceptin
    complexed with nag, so4

Details for d1n8zb2

PDB Entry: 1n8z (more details), 2.52 Å

PDB Description: crystal structure of extracellular domain of human her2 complexed with herceptin fab
PDB Compounds: (B:) Herceptin Fab (antibody) - heavy chain

SCOPe Domain Sequences for d1n8zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8zb2 b.1.1.2 (B:121-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d1n8zb2:

Click to download the PDB-style file with coordinates for d1n8zb2.
(The format of our PDB-style files is described here.)

Timeline for d1n8zb2: