Lineage for d1n8yc4 (1n8y C:489-608)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747642Superfamily g.3.9: Growth factor receptor domain [57184] (1 family) (S)
  5. 747643Family g.3.9.1: Growth factor receptor domain [57185] (5 proteins)
  6. 747662Protein Protooncoprotein Her2 extracellular domain [82889] (2 species)
  7. 747670Species Rat (Rattus norvegicus) [TaxId:10116] [82891] (1 PDB entry)
  8. 747672Domain d1n8yc4: 1n8y C:489-608 [80317]
    Other proteins in same PDB: d1n8yc1, d1n8yc2
    complexed with nag

Details for d1n8yc4

PDB Entry: 1n8y (more details), 2.4 Å

PDB Description: crystal structure of the extracellular region of rat her2
PDB Compounds: (C:) protooncoprotein

SCOP Domain Sequences for d1n8yc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8yc4 g.3.9.1 (C:489-608) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]}
vcnslcahghcwgpgptqcvncshflrgqecveecrvwkglpreyvsdkrclpchpecqp
qnssetcfgseadqcaacahykdssscvarcpsgvkpdlsympiwkypdeegicqpcpin

SCOP Domain Coordinates for d1n8yc4:

Click to download the PDB-style file with coordinates for d1n8yc4.
(The format of our PDB-style files is described here.)

Timeline for d1n8yc4: