Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) |
Family g.3.9.1: Growth factor receptor domain [57185] (11 proteins) Pfam PF00757; Pfam PF14843; Pfam PF15913 heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures |
Protein Protooncoprotein Her2 extracellular domain [82889] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [82891] (1 PDB entry) |
Domain d1n8yc4: 1n8y C:489-608 [80317] Other proteins in same PDB: d1n8yc1, d1n8yc2 complexed with nag |
PDB Entry: 1n8y (more details), 2.4 Å
SCOPe Domain Sequences for d1n8yc4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n8yc4 g.3.9.1 (C:489-608) Protooncoprotein Her2 extracellular domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} vcnslcahghcwgpgptqcvncshflrgqecveecrvwkglpreyvsdkrclpchpecqp qnssetcfgseadqcaacahykdssscvarcpsgvkpdlsympiwkypdeegicqpcpin
Timeline for d1n8yc4: