Lineage for d1n8yc3 (1n8y C:166-322)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2257965Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 2257966Family g.3.9.1: Growth factor receptor domain [57185] (10 proteins)
    Pfam PF00757; Pfam PF14843; Pfam PF15913
  6. 2257997Protein Protooncoprotein Her2 extracellular domain [82889] (2 species)
  7. 2258005Species Norway rat (Rattus norvegicus) [TaxId:10116] [82891] (1 PDB entry)
  8. 2258006Domain d1n8yc3: 1n8y C:166-322 [80316]
    Other proteins in same PDB: d1n8yc1, d1n8yc2
    complexed with nag

Details for d1n8yc3

PDB Entry: 1n8y (more details), 2.4 Å

PDB Description: Crystal structure of the extracellular region of rat HER2
PDB Compounds: (C:) protooncoprotein

SCOPe Domain Sequences for d1n8yc3:

Sequence, based on SEQRES records: (download)

>d1n8yc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nrsracppcapackdnhcwgespedcqiltgtictsgcarckgrlptdccheqcaagctg
pkhsdclaclhfnhsgicelhcpalvtyntdtfesmhnpegrytfgascvttcpynylst
evgsctlvcppnnqevtaedgtqrcekcskpcarvcy

Sequence, based on observed residues (ATOM records): (download)

>d1n8yc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nrsracppcapackdnhcwgespedcqiltgtictsgcarckgrlptdccheqcaagctg
pkhsdclaclhfnhsgicelhcpalvtyesmhnpegrytfgascvttcpynylstevgsc
tlvcppnnqevtaedgtqrcekcskpcarvcy

SCOPe Domain Coordinates for d1n8yc3:

Click to download the PDB-style file with coordinates for d1n8yc3.
(The format of our PDB-style files is described here.)

Timeline for d1n8yc3: