Lineage for d1n8yc3 (1n8y C:166-322)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889538Superfamily g.3.9: Growth factor receptor domain [57184] (1 family) (S)
  5. 889539Family g.3.9.1: Growth factor receptor domain [57185] (8 proteins)
  6. 889580Protein Protooncoprotein Her2 extracellular domain [82889] (2 species)
  7. 889588Species Rat (Rattus norvegicus) [TaxId:10116] [82891] (1 PDB entry)
  8. 889589Domain d1n8yc3: 1n8y C:166-322 [80316]
    Other proteins in same PDB: d1n8yc1, d1n8yc2

Details for d1n8yc3

PDB Entry: 1n8y (more details), 2.4 Å

PDB Description: Crystal structure of the extracellular region of rat HER2
PDB Compounds: (C:) protooncoprotein

SCOP Domain Sequences for d1n8yc3:

Sequence, based on SEQRES records: (download)

>d1n8yc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]}
nrsracppcapackdnhcwgespedcqiltgtictsgcarckgrlptdccheqcaagctg
pkhsdclaclhfnhsgicelhcpalvtyntdtfesmhnpegrytfgascvttcpynylst
evgsctlvcppnnqevtaedgtqrcekcskpcarvcy

Sequence, based on observed residues (ATOM records): (download)

>d1n8yc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]}
nrsracppcapackdnhcwgespedcqiltgtictsgcarckgrlptdccheqcaagctg
pkhsdclaclhfnhsgicelhcpalvtyesmhnpegrytfgascvttcpynylstevgsc
tlvcppnnqevtaedgtqrcekcskpcarvcy

SCOP Domain Coordinates for d1n8yc3:

Click to download the PDB-style file with coordinates for d1n8yc3.
(The format of our PDB-style files is described here.)

Timeline for d1n8yc3: