SCOP 1.73: Domain d1n8pb_: 1n8p B:

Lineage for d1n8pb_ (1n8p B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (8 families)

5. Family c.67.1.3: Cystathionine synthase-like [53402] (16 proteins)

6. Protein Cystathionine gamma-lyase (CYS3) [82484] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82485] (1 PDB entry)

8. Domain d1n8pb_: 1n8p B: [80305]

Details for d1n8pb_

PDB Entry: 1n8p, 2.6 Å

PDB Description: Crystal Structure of cystathionine gamma-lyase from yeast

PDB Compounds: (B:) Cystathionine gamma-lyase

SCOP Domain Sequences for d1n8pb_:

Sequence; same for both SEQRES and ATOM records:

>d1n8pb_ c.67.1.3 (B:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlqesdkfatkaihagehvdvhgsviepislsttfkqsspanpigtyeysrsqnpnrenl
eravaalenaqyglafssgsattatilqslpqgshavsigdvyggthryftkvanahgve
tsftndllndlpqlikentklvwietptnptlkvtdiqkvadlikkhaagqdvilvvdnt
flspyisnplnfgadivvhsatkyinghsdvvlgvlatnnkplyerlqflqnaigaipsp
fdawlthrglktlhlrvrqaalsankiaeflaadkenvvavnypglkthpnydvvlkqhr
dalgggmisfrikggaeaaskfasstrlftlaeslggiesllevpavmthggipkearea
sgvfddlvrisvgiedtddlledikqalkqatn

Timeline for d1n8pb_:

• d1n8pb_ first appeared in SCOP 1.63
  
• d1n8pb_ appears in SCOP 1.71
  
• d1n8pb_ appears in SCOP 1.75
  
• d1n8pb_ appears in the current release, SCOPe 2.08