SCOP 1.71: Domain d1n8ef2: 1n8e F:97-141

Lineage for d1n8ef2 (1n8e F:97-141)

1. Root: SCOP 1.71

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (29 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen gamma chain [88898] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88900] (15 PDB entries)

8. Domain d1n8ef2: 1n8e F:97-141 [80296]
   Other proteins in same PDB: d1n8ea_, d1n8eb1, d1n8eb2, d1n8ec1, d1n8ed_, d1n8ee1, d1n8ee2, d1n8ef1
   coiled-coil region only

Details for d1n8ef2

PDB Entry: 1n8e, 4.5 Å

PDB Description: Fragment Double-D from Human Fibrin

SCOP Domain Sequences for d1n8ef2:

Sequence; same for both SEQRES and ATOM records:

>d1n8ef2 h.1.8.1 (F:97-141) Fibrinogen gamma chain {Human (Homo sapiens)}
easilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckd

Timeline for d1n8ef2:

• d1n8ef2 first appeared in SCOP 1.63
  
• d1n8ef2 appears in SCOP 1.69
  
• d1n8ef2 appears in SCOP 1.73
  
• d1n8ef2 appears in the current release, SCOPe 2.08