Lineage for d1n8ef1 (1n8e F:142-391)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 337110Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 337111Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) (S)
  5. 337112Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
  6. 337113Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 337150Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (15 PDB entries)
  8. 337176Domain d1n8ef1: 1n8e F:142-391 [80295]
    Other proteins in same PDB: d1n8ea_, d1n8eb2, d1n8ec2, d1n8ed_, d1n8ee2, d1n8ef2

Details for d1n8ef1

PDB Entry: 1n8e (more details), 4.5 Å

PDB Description: Fragment Double-D from Human Fibrin

SCOP Domain Sequences for d1n8ef1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8ef1 d.171.1.1 (F:142-391) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnr

SCOP Domain Coordinates for d1n8ef1:

Click to download the PDB-style file with coordinates for d1n8ef1.
(The format of our PDB-style files is described here.)

Timeline for d1n8ef1: