SCOPe 2.06: Domain d1n8eb2: 1n8e B:151-199

Lineage for d1n8eb2 (1n8e B:151-199)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen beta chain [88892] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries)
   Uniprot P02675

8. Domain d1n8eb2: 1n8e B:151-199 [80289]
   Other proteins in same PDB: d1n8ea_, d1n8eb1, d1n8ec1, d1n8ec2, d1n8ed_, d1n8ee1, d1n8ef1, d1n8ef2
   coiled-coil region only

Details for d1n8eb2

PDB Entry: 1n8e, 4.5 Å

PDB Description: Fragment Double-D from Human Fibrin

PDB Compounds: (B:) Fibrin beta chain

SCOPe Domain Sequences for d1n8eb2:

Sequence; same for both SEQRES and ATOM records:

>d1n8eb2 h.1.8.1 (B:151-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]}
lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv

Timeline for d1n8eb2:

• d1n8eb2 first appeared in SCOP 1.63
  
• d1n8eb2 appears in SCOPe 2.05
  
• d1n8eb2 appears in SCOPe 2.07
  
• d1n8eb2 appears in the current release, SCOPe 2.08