Lineage for d1n8ea_ (1n8e A:)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 894740Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 895301Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 895302Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 895303Protein Fibrinogen alpha chain [88887] (4 species)
  7. 895312Species Human (Homo sapiens) [TaxId:9606] [88889] (22 PDB entries)
    Uniprot P02671 150-209
  8. 895358Domain d1n8ea_: 1n8e A: [80287]
    Other proteins in same PDB: d1n8eb1, d1n8eb2, d1n8ec1, d1n8ec2, d1n8ee1, d1n8ee2, d1n8ef1, d1n8ef2
    coiled-coil region only

Details for d1n8ea_

PDB Entry: 1n8e (more details), 4.5 Å

PDB Description: Fragment Double-D from Human Fibrin
PDB Compounds: (A:) Fibrin alpha/alpha-E chain

SCOP Domain Sequences for d1n8ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8ea_ h.1.8.1 (A:) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]}
ievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdy
edqqkqleqviakd

SCOP Domain Coordinates for d1n8ea_:

Click to download the PDB-style file with coordinates for d1n8ea_.
(The format of our PDB-style files is described here.)

Timeline for d1n8ea_: