Lineage for d1n86e1 (1n86 E:200-457)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 264784Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 264785Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) (S)
  5. 264786Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
  6. 264787Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 264794Species Human (Homo sapiens), beta [TaxId:9606] [68903] (10 PDB entries)
  8. 264810Domain d1n86e1: 1n86 E:200-457 [80283]
    Other proteins in same PDB: d1n86a_, d1n86b2, d1n86c2, d1n86d_, d1n86e2, d1n86f2
    complexed with ca, man, nag

Details for d1n86e1

PDB Entry: 1n86 (more details), 3.2 Å

PDB Description: Crystal structure of human D-dimer from cross-linked fibrin complexed with GPR and GHRPLDK peptide ligands.

SCOP Domain Sequences for d1n86e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n86e1 d.171.1.1 (E:200-457) Fibrinogen C-terminal domains {Human (Homo sapiens), beta}
scnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgs
vdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkg
dkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstyd
rdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmn
wkgswysmrkmsmkirpf

SCOP Domain Coordinates for d1n86e1:

Click to download the PDB-style file with coordinates for d1n86e1.
(The format of our PDB-style files is described here.)

Timeline for d1n86e1: