Lineage for d1n86d_ (1n86 D:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 344850Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 345233Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 345234Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two tripple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 345235Protein Fibrinogen alpha chain [88887] (4 species)
  7. 345244Species Human (Homo sapiens) [TaxId:9606] [88889] (10 PDB entries)
  8. 345260Domain d1n86d_: 1n86 D: [80282]
    Other proteins in same PDB: d1n86b1, d1n86b2, d1n86c1, d1n86c2, d1n86e1, d1n86e2, d1n86f1, d1n86f2
    coiled-coil region only
    complexed with ca, man, nag

Details for d1n86d_

PDB Entry: 1n86 (more details), 3.2 Å

PDB Description: crystal structure of human d-dimer from cross-linked fibrin complexed with gpr and ghrpldk peptide ligands.

SCOP Domain Sequences for d1n86d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n86d_ h.1.8.1 (D:) Fibrinogen alpha chain {Human (Homo sapiens)}
ievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdy
edqqkqleqviakd

SCOP Domain Coordinates for d1n86d_:

Click to download the PDB-style file with coordinates for d1n86d_.
(The format of our PDB-style files is described here.)

Timeline for d1n86d_: