Class h: Coiled coil proteins [57942] (6 folds) |
Fold h.1: Parallel coiled-coil [57943] (26 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two tripple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Protein Fibrinogen alpha chain [88887] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88889] (10 PDB entries) |
Domain d1n86d_: 1n86 D: [80282] Other proteins in same PDB: d1n86b1, d1n86b2, d1n86c1, d1n86c2, d1n86e1, d1n86e2, d1n86f1, d1n86f2 coiled-coil region only complexed with ca, man, nag |
PDB Entry: 1n86 (more details), 3.2 Å
SCOP Domain Sequences for d1n86d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n86d_ h.1.8.1 (D:) Fibrinogen alpha chain {Human (Homo sapiens)} ievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdy edqqkqleqviakd
Timeline for d1n86d_: