Class h: Coiled coil proteins [57942] (6 folds) |
Fold h.1: Parallel coiled-coil [57943] (26 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.15: SNARE fusion complex [58038] (1 family) tetrameric parallel coiled coil |
Family h.1.15.1: SNARE fusion complex [58039] (10 proteins) |
Protein Syntaxin 1A [88908] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [88909] (5 PDB entries) a globular structure of a larger fragment containing this region is available; (1dn1), chain B or (d1dn1b_)_ |
Domain d1n7sb_: 1n7s B: [80272] Other proteins in same PDB: d1n7sa_, d1n7sc_, d1n7sd_ complex with synaptobrevin and SNAP-25 fragments |
PDB Entry: 1n7s (more details), 1.45 Å
SCOP Domain Sequences for d1n7sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n7sb_ h.1.15.1 (B:) Syntaxin 1A {Rat (Rattus norvegicus)} gsalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyverav sdtkkavk
Timeline for d1n7sb_: