Lineage for d1n7sb_ (1n7s B:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 344850Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 345390Superfamily h.1.15: SNARE fusion complex [58038] (1 family) (S)
    tetrameric parallel coiled coil
  5. 345391Family h.1.15.1: SNARE fusion complex [58039] (10 proteins)
  6. 345431Protein Syntaxin 1A [88908] (2 species)
  7. 345434Species Rat (Rattus norvegicus) [TaxId:10116] [88909] (5 PDB entries)
    a globular structure of a larger fragment containing this region is available; (1dn1), chain B or (d1dn1b_)_
  8. 345435Domain d1n7sb_: 1n7s B: [80272]
    Other proteins in same PDB: d1n7sa_, d1n7sc_, d1n7sd_
    complex with synaptobrevin and SNAP-25 fragments

Details for d1n7sb_

PDB Entry: 1n7s (more details), 1.45 Å

PDB Description: high resolution structure of a truncated neuronal snare complex

SCOP Domain Sequences for d1n7sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7sb_ h.1.15.1 (B:) Syntaxin 1A {Rat (Rattus norvegicus)}
gsalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyverav
sdtkkavk

SCOP Domain Coordinates for d1n7sb_:

Click to download the PDB-style file with coordinates for d1n7sb_.
(The format of our PDB-style files is described here.)

Timeline for d1n7sb_: