SCOPe 2.08: Domain d1n7sb1: 1n7s B:191-256

Lineage for d1n7sb1 (1n7s B:191-256)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (2 families)
   tetrameric parallel coiled coil

5. Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)

6. Protein Syntaxin 1A [88908] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88909] (6 PDB entries)
   Uniprot P32851 196-259
   a globular structure of a larger fragment containing this region is available; seepdb:1dn1, chain B

8. Domain d1n7sb1: 1n7s B:191-256 [80272]
   Other proteins in same PDB: d1n7sa1, d1n7sa2, d1n7sb2, d1n7sc1, d1n7sc2, d1n7sd1, d1n7sd2
   complex with synaptobrevin and SNAP-25 fragments
   complexed with ca, mpd

Details for d1n7sb1

PDB Entry: 1n7s, 1.45 Å

PDB Description: high resolution structure of a truncated neuronal snare complex

PDB Compounds: (B:) syntaxin 1a

SCOPe Domain Sequences for d1n7sb1:

Sequence; same for both SEQRES and ATOM records:

>d1n7sb1 h.1.15.1 (B:191-256) Syntaxin 1A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravsd
tkkavk

Timeline for d1n7sb1:

• d1n7sb1 first appeared in SCOP 1.63, called d1n7sb_
  
• d1n7sb1 appears in SCOPe 2.07