Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Metal chelatase catalytic Fab 7G12, (human), kappa L chain [48879] (5 PDB entries) |
Domain d1n7ml1: 1n7m L:1-114 [80254] Other proteins in same PDB: d1n7mh2, d1n7ml2 germline antibody; chain identifiers are probably mixed up (H is the light chain, L is the heavy chain) complexed with mmp |
PDB Entry: 1n7m (more details), 1.8 Å
SCOP Domain Sequences for d1n7ml1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n7ml1 b.1.1.1 (L:1-114) Immunoglobulin (variable domains of L and H chains) {Metal chelatase catalytic Fab 7G12, (human), kappa L chain} qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky nekfkskatltvdkpsstaymqlssltsedsavyyctrrdsdywgagttvtvss
Timeline for d1n7ml1: