SCOPe 2.01: Domain d1n7mh1: 1n7m H:1-107

Lineage for d1n7mh1 (1n7m H:1-107)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (184 PDB entries)
   Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor

8. Domain d1n7mh1: 1n7m H:1-107 [80252]
   Other proteins in same PDB: d1n7mh2, d1n7ml1, d1n7ml2
   part of metal chelatase catalytic Fab 7G12; germline antibody; chain identifiers are probably mixed up
   complexed with mmp

Details for d1n7mh1

PDB Entry: 1n7m, 1.8 Å

PDB Description: Germline 7G12 with N-methylmesoporphyrin

PDB Compounds: (H:) Germline Metal Chelatase Catalytic Antibody, chain H

SCOPe Domain Sequences for d1n7mh1:

Sequence; same for both SEQRES and ATOM records:

>d1n7mh1 b.1.1.1 (H:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
elvmtqtpkfmstsvgdrvsitckasqnvgtavawyqqkpgqspklliysasnrytgvpd
rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveik

Timeline for d1n7mh1:

• d1n7mh1 first appeared in SCOP 1.63
  
• d1n7mh1 appears in SCOP 1.75
  
• d1n7mh1 appears in SCOPe 2.02
  
• d1n7mh1 appears in the current release, SCOPe 2.08