SCOP 1.63: Domain d1n7mh1: 1n7m H:1-107

Lineage for d1n7mh1 (1n7m H:1-107)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Metal chelatase catalytic Fab 7G12, (human), kappa L chain [48879] (5 PDB entries)

8. Domain d1n7mh1: 1n7m H:1-107 [80252]
   Other proteins in same PDB: d1n7mh2, d1n7ml2

Details for d1n7mh1

PDB Entry: 1n7m, 1.8 Å

PDB Description: Germline 7G12 with N-methylmesoporphyrin

SCOP Domain Sequences for d1n7mh1:

Sequence; same for both SEQRES and ATOM records:

>d1n7mh1 b.1.1.1 (H:1-107) Immunoglobulin (variable domains of L and H chains) {Metal chelatase catalytic Fab 7G12, (human), kappa L chain}
elvmtqtpkfmstsvgdrvsitckasqnvgtavawyqqkpgqspklliysasnrytgvpd
rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveik

Timeline for d1n7mh1:

• d1n7mh1 is new in SCOP 1.63
  
• d1n7mh1 appears in SCOP 1.65
  
• d1n7mh1 appears in the current release, SCOPe 2.08