Lineage for d1n7daa (1n7d A:252-295)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260002Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 2260003Superfamily g.12.1: LDL receptor-like module [57424] (2 families) (S)
  5. 2260004Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)
  6. 2260014Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)
  7. 2260015Species Human (Homo sapiens) [TaxId:9606] [57427] (13 PDB entries)
    Uniprot P01130 272-353
  8. 2260035Domain d1n7daa: 1n7d A:252-295 [80245]
    Other proteins in same PDB: d1n7da1, d1n7da2, d1n7da3, d1n7da4
    all but the first modules in the whole receptor structure context
    complexed with ca, keg

Details for d1n7daa

PDB Entry: 1n7d (more details), 3.7 Å

PDB Description: extracellular domain of the ldl receptor
PDB Compounds: (A:) low-density lipoprotein receptor

SCOPe Domain Sequences for d1n7daa:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7daa g.12.1.1 (A:252-295) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
vtlcegpnkfkchsgecitldkvcnmardcrdwsdepikecgtn

SCOPe Domain Coordinates for d1n7daa:

Click to download the PDB-style file with coordinates for d1n7daa.
(The format of our PDB-style files is described here.)

Timeline for d1n7daa: