Lineage for d1n7da9 (1n7d A:212-251)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 342976Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulphide-rich calcium-binding fold
  4. 342977Superfamily g.12.1: LDL receptor-like module [57424] (1 family) (S)
  5. 342978Family g.12.1.1: LDL receptor-like module [57425] (2 proteins)
  6. 342979Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)
  7. 342980Species Human (Homo sapiens) [TaxId:9606] [57427] (10 PDB entries)
  8. 342995Domain d1n7da9: 1n7d A:212-251 [80244]
    Other proteins in same PDB: d1n7da1, d1n7da2, d1n7da3, d1n7da4

Details for d1n7da9

PDB Entry: 1n7d (more details), 3.7 Å

PDB Description: extracellular domain of the ldl receptor

SCOP Domain Sequences for d1n7da9:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7da9 g.12.1.1 (A:212-251) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens)}
vatcrpdefqcsdgncihgsrqcdreydckdmsdevgcvn

SCOP Domain Coordinates for d1n7da9:

Click to download the PDB-style file with coordinates for d1n7da9.
(The format of our PDB-style files is described here.)

Timeline for d1n7da9: