Lineage for d1n73f2 (1n73 F:83-137)

  1. Root: SCOP 1.67
  2. 431023Class h: Coiled coil proteins [57942] (6 folds)
  3. 431024Fold h.1: Parallel coiled-coil [57943] (27 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 431436Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 431437Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 431524Protein Fibrinogen gamma chain [88898] (4 species)
  7. 431560Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [88902] (2 PDB entries)
  8. 431566Domain d1n73f2: 1n73 F:83-137 [80223]
    Other proteins in same PDB: d1n73a_, d1n73b1, d1n73b2, d1n73c1, d1n73d_, d1n73e1, d1n73e2, d1n73f1
    coiled-coil region only
    complexed with ca, nag

Details for d1n73f2

PDB Entry: 1n73 (more details), 2.9 Å

PDB Description: fibrin d-dimer, lamprey complexed with the peptide ligand: gly-his- arg-pro-amide

SCOP Domain Sequences for d1n73f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n73f2 h.1.8.1 (F:83-137) Fibrinogen gamma chain {Sea lamprey (Petromyzon marinus)}
ktvqkileevrileqigvshdaqiqelsemwrvnqqfvtrlqqqlvdirqtcsrs

SCOP Domain Coordinates for d1n73f2:

Click to download the PDB-style file with coordinates for d1n73f2.
(The format of our PDB-style files is described here.)

Timeline for d1n73f2: